Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR169W-A (YPR169W-A)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR169W-A (YPR169W-A) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YPR169W-A

UniProt

P0C5R7

Expression Region

1-72

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAYVIFSYLFRR YPFTISYISPPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF647 conjugate, 0.1mg/mL
BNC470531-100 1x 100 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF640R conjugate, 0.1mg/mL
BNC401813-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details