Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacillus stearothermophilus ATP synthase subunit c (atpE)

This Recombinant Geobacillus stearothermophilus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P42011

Expression Region

1-72

Origin

Geobacillus stearothermophilus (Bacillus stearothermophilus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVLAAAIAVGLGALGAGIANGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPI IGVVFSFIYLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF640R conjugate, 0.1mg/mL
BNC400901-500 1x 500 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF594 conjugate, 0.1mg/mL
BNC941815-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF555 conjugate, 0.1mg/mL
BNC550393-100 1x 100 µL

Cytokeratin, multi (C11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details