Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P41015

Expression Region

1-72

Origin

Bacillus caldotenax

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIAAQPELRPVLQTTMFIGVALVEALPI IGVVFSFIYLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF-4 CRISPR Activation Plasmid (m)
sc-425288-ACT 20 µg

PF-4 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal West Nile Virus Envelope Antibody [CoraFluor 1]
NBP2-41057CL1 0.1 mL

Rabbit Polyclonal West Nile Virus Envelope Antibody [CoraFluor 1]

Sign In for Pricing
View Details
LGI3 Double Nickase Plasmid (h2)
sc-409392-NIC-2 20 µg

LGI3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Human Protein-tyrosine kinase 2-beta (PTK2B) ELISA Kit
EK7988 48 Tests

Human Protein-tyrosine kinase 2-beta (PTK2B) ELISA Kit

Sign In for Pricing
View Details
ZBTB42 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50711066 1.0 µg DNA

ZBTB42 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
NUDT21 Mouse Monoclonal Antibody [Clone ID: LBI5B3]
AMM17456V 100 µL

NUDT21 Mouse Monoclonal Antibody [Clone ID: LBI5B3]

Sign In for Pricing
View Details