Recombinant ATP synthase subunit c (atpE)
This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
P41015
Expression Region
1-72
Origin
Bacillus caldotenax
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIAAQPELRPVLQTTMFIGVALVEALPI IGVVFSFIYLGR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4730003 1.0 µg DNA
Zfp706 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
K3169205 3x 1.0 µg
7420426K07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details