Recombinant Malassezia globosa Assembly factor CBP4 (CBP4)
This Recombinant Malassezia globosa Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-73.
Product Specifications
Product Name Alternative
Assembly factor CBP4, Cytochrome b mRNA processing protein 4
UniProt
A8PYF7
Expression Region
1-73
Origin
Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAGGPANWARAITGGSVVIGFGYLLLKTATPNEQQLYDSLSPDLKRRVDAQRSSQADSER SAKVKEEQSKRLV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682428-100 1x 100 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
