Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Malassezia globosa Assembly factor CBP4 (CBP4)

This Recombinant Malassezia globosa Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Assembly factor CBP4, Cytochrome b mRNA processing protein 4

UniProt

A8PYF7

Expression Region

1-73

Origin

Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGGPANWARAITGGSVVIGFGYLLLKTATPNEQQLYDSLSPDLKRRVDAQRSSQADSER SAKVKEEQSKRLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD49d (PS/2) In Vivo Antibody - Low Endotoxin
ICH1200-25mg 25 mg

Anti-Mouse CD49d (PS/2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
4-O-Beta-Galactopyranosyl-D-mannopyrase-octaacetate
TRC-G154860-1G 1 g

4-O-Beta-Galactopyranosyl-D-mannopyrase-octaacetate

Sign In for Pricing
View Details
4,4'-Dichlorodiphenyltrichloroethane - d8
TRC-D434197-5MG 5 mg

4,4'-Dichlorodiphenyltrichloroethane - d8

Sign In for Pricing
View Details
RAN (N-term) Rabbit Polyclonal Antibody
AP17702PU-N 400 µL

RAN (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD177 (NM_020406) Human Recombinant Protein
TP306463M 100 µg

CD177 (NM_020406) Human Recombinant Protein

Sign In for Pricing
View Details
Rho Mouse Gene Knockout Kit (CRISPR)
KN514762 1 Kit

Rho Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details