Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2158 (AF_2158)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2158 (AF_2158) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2158

UniProt

O28124

Expression Region

1-73

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEGETVRKILLAILFFALVVSLVGLYVSANVMIDVWAGQKYSTVYKVLMNAAMLLIVIY LIQRLIIQPRNSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS709922 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant ARAF Antibody
RN-005-01 50 μL

Recombinant ARAF Antibody

Sign In for Pricing
View Details
Recombinant ARAF Antibody
RN-005-02 100 µL

Recombinant ARAF Antibody

Sign In for Pricing
View Details
Recombinant ARAF Antibody
RN-005-03 1 mL

Recombinant ARAF Antibody

Sign In for Pricing
View Details
PFKL (NM_001002021) Human Over-expression Lysate
LC424324 20 µg

PFKL (NM_001002021) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: AT1F5]
AM09068PU-N 100 µL

Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: AT1F5]

Sign In for Pricing
View Details