Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2158 (AF_2158)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2158 (AF_2158) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2158

UniProt

O28124

Expression Region

1-73

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEGETVRKILLAILFFALVVSLVGLYVSANVMIDVWAGQKYSTVYKVLMNAAMLLIVIY LIQRLIIQPRNSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

m-Toluidine-2,4,6-d3
TRC-M536227-5MG 5 mg

m-Toluidine-2,4,6-d3

Sign In for Pricing
View Details
IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF814528 100 µg

IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

Sign In for Pricing
View Details
4,8,12,15,19-Docosapentaenoic Acid
TRC-D254850-100MG 100 mg

4,8,12,15,19-Docosapentaenoic Acid

Sign In for Pricing
View Details
Ep-CAM / CD326 (Rat) (GZ-20), 0.2mg/mL
BNUB0382-100 1x 100 µL

Ep-CAM / CD326 (Rat) (GZ-20), 0.2mg/mL

Sign In for Pricing
View Details
Human POLR3GL activation kit by CRISPRa
GA113462 1 Kit

Human POLR3GL activation kit by CRISPRa

Sign In for Pricing
View Details
SASH1 Human Gene Knockout Kit (CRISPR)
KN418866 1 Kit

SASH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details