Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YKL065W-A (YKL065W-A)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YKL065W-A (YKL065W-A) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Uncharacterized protein YKL065W-A

UniProt

Q2V2P2

Expression Region

1-73

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSNILKLLQRTSRRYVSSKDFEPVIGSNPKKQTSRLMVGSVGVMIPVLLYLFYKNDSKH SEIKKIYQNEKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-100 1x 100 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-500 1x 500 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details