Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit e (VMA9)

This Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit e (VMA9) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e, V-ATPase subunit e, Low dye-binding protein 10, Vacuolar proton pump subunit e

UniProt

Q3E7B6

Expression Region

1-73

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSFYTVVGVFIVVSAMSVLFWIMAPKNNQAVWRSTVILTLAMMFLMWAITFLCQLHPLV APRRSDLRPEFAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-100 1x 100 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DP) (beta chain) (Bra-14), CF647 conjugate, 0.1mg/mL
BNC471129-500 1x 500 µL

MHC II (HLA-DP) (beta chain) (Bra-14), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF488A conjugate, 0.1mg/mL
BNC882097-100 1x 100 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528), CF640R conjugate, 0.1mg/mL
BNC400528-500 1x 500 µL

ZAP70 (ZAP70/528), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Rabbit PAb), CF740 conjugate, 0.1mg/mL
BNC740731-100 1x 100 µL

AMACR / p504S (Rabbit PAb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details