Recombinant Southern cowpea mosaic virus Polyprotein P2A (ORF2A)
This Recombinant Southern cowpea mosaic virus Polyprotein P2A (ORF2A) spans the amino acid sequence from region 500-572.
Product Specifications
Product Name Alternative
Polyprotein P2A, Cleaved into the following 5 chains:, 1. N-terminal protein, 2. Serine protease, EC= 3. 3.4.21.-, 4. VPg, 5. Putative protein p10, 6. Putative protein p8
UniProt
Q83470
Expression Region
500-572
Origin
Southern cowpea mosaic virus (SCPMV) (Southern bean mosaic virus (strain cowpea) )
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SLFPPKPRATSSKPITTSSPGTPGRSPLPVSGKELGPSTQSSSKLSRKQRRRRSTKRPVQ GSPSPASPPPTRT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740270-500 1x 500 µL
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881541-100 1x 100 µL
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details