Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein I2 (I2L)

This Recombinant Vaccinia virus Protein I2 (I2L) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Protein I2

UniProt

P68605

Expression Region

1-73

Origin

Vaccinia virus (strain L-IVP) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKIL Antibody
8C10353-AAT 50 µg

SKIL Antibody

Sign In for Pricing
View Details
beta Synuclein (SNCB) Human Gene Knockout Kit (CRISPR)
KN402449 1 Kit

beta Synuclein (SNCB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TFB2M (NM_022366) Human Over-expression Lysate
LC402922 20 µg

TFB2M (NM_022366) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2792), CF640R conjugate, 0.1mg/mL
BNC402792-500 1x 500 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2792), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R)-alpha-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid
TRC-E916970-1G 1 g

(R)-alpha-[[(4-Ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]benzeneacetic Acid

Sign In for Pricing
View Details
Extra Shelf, 12.0 x 15.0", stainless steel
H2265-SH 1 Each

Extra Shelf, 12.0 x 15.0", stainless steel

Sign In for Pricing
View Details