Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein I2 (I2L)

This Recombinant Vaccinia virus Protein I2 (I2L) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Protein I2

UniProt

P68605

Expression Region

1-73

Origin

Vaccinia virus (strain L-IVP) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®680 Monoclonal Mouse Anti-6X His IgG, 1 mg/mL
#20359 1x 50 µL

CF®680 Monoclonal Mouse Anti-6X His IgG, 1 mg/mL

Sign In for Pricing
View Details
SuLT1A4 (NM_001017390) Human Recombinant Protein
TP309931M 100 µg

SuLT1A4 (NM_001017390) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB508653 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Human VCAM-1/CD106 Antibody Pair Set
E-KAB-0456 50 µL & 100 µg

Human VCAM-1/CD106 Antibody Pair Set

Sign In for Pricing
View Details
LTC4S (N-term) Rabbit Polyclonal Antibody
AP18104PU-N 400 µL

LTC4S (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protein G Colloidal Gold, 1mL 10nm
GP-02-10 1 mL

Protein G Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details