Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein I2 (I2L)

This Recombinant Vaccinia virus Protein I2 (I2L) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Protein I2

UniProt

P68605

Expression Region

1-73

Origin

Vaccinia virus (strain L-IVP) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF3 Antibody
KC-16349-01 50 μL

TRAF3 Antibody

Sign In for Pricing
View Details
TRAF3 Antibody
KC-16349-02 100 µL

TRAF3 Antibody

Sign In for Pricing
View Details
TRAF3 Antibody
KC-16349-03 1 mL

TRAF3 Antibody

Sign In for Pricing
View Details
CA8 (NM_004056) Human Over-expression Lysate
LY418248 100 µg

CA8 (NM_004056) Human Over-expression Lysate

Sign In for Pricing
View Details
ZFYVE19 Polyclonal Antibody
E-AB-53236-01 20 µL

ZFYVE19 Polyclonal Antibody

Sign In for Pricing
View Details
ZFYVE19 Polyclonal Antibody
E-AB-53236-02 60 µL

ZFYVE19 Polyclonal Antibody

Sign In for Pricing
View Details