Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus Protein I2 (I2L)

This Recombinant Variola virus Protein I2 (I2L) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Protein I2

UniProt

P68607

Expression Region

1-73

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP4A1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV697373 1.0 µg DNA

PTP4A1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CCDC68 siRNA (Mouse)
MBS828190-01 15 nmol

CCDC68 siRNA (Mouse)

Sign In for Pricing
View Details
CCDC68 siRNA (Mouse)
MBS828190-02 30 nmol

CCDC68 siRNA (Mouse)

Sign In for Pricing
View Details
CCDC68 siRNA (Mouse)
MBS828190-03 5x 30 nmol

CCDC68 siRNA (Mouse)

Sign In for Pricing
View Details
POTB7-KRT14
PPL00750 1 Each

POTB7-KRT14

Sign In for Pricing
View Details
ESRRG Polyclonal Antibody
E-AB-14996-01 20 µL

ESRRG Polyclonal Antibody

Sign In for Pricing
View Details