Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein I2 (I2L)

This Recombinant Vaccinia virus Protein I2 (I2L) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Protein I2

UniProt

P68604

Expression Region

1-73

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoic Acid Receptor alpha (RARA) (NM_001024809) Human Over-expression Lysate
LC422542 20 µg

Retinoic Acid Receptor alpha (RARA) (NM_001024809) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Slc25a15 activation kit by CRISPRa
GA203061 1 Kit

Mouse Slc25a15 activation kit by CRISPRa

Sign In for Pricing
View Details
RNF90 (TRIM7) (NM_203297) Human Over-expression Lysate
LC404381 20 µg

RNF90 (TRIM7) (NM_203297) Human Over-expression Lysate

Sign In for Pricing
View Details
ASCC2 (NM_032204) Human Recombinant Protein
TP303391L 1 mg

ASCC2 (NM_032204) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant IRF8 Antibody
RC-5394-01 50 μL

Recombinant IRF8 Antibody

Sign In for Pricing
View Details
Recombinant IRF8 Antibody
RC-5394-02 100 µL

Recombinant IRF8 Antibody

Sign In for Pricing
View Details