Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein I2 (I2L)

This Recombinant Vaccinia virus Protein I2 (I2L) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Protein I2

UniProt

P68604

Expression Region

1-73

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / CD340 (HRB2/282), Biotin conjugate, 0.1mg/mL
BNCB0282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte Marker (BM-2), 0.2mg/mL
BNUB0062-100 1x 100 µL

Granulocyte Marker (BM-2), 0.2mg/mL

Sign In for Pricing
View Details
MRAP2 Human qPCR Primer Pair (NM_138409)
HP216964 200 Reactions

MRAP2 Human qPCR Primer Pair (NM_138409)

Sign In for Pricing
View Details
Purified Anti-Human CD138 Antibody[DL-101]
E-AB-F1154A-01 25 µg

Purified Anti-Human CD138 Antibody[DL-101]

Sign In for Pricing
View Details
Purified Anti-Human CD138 Antibody[DL-101]
E-AB-F1154A-02 100 µg

Purified Anti-Human CD138 Antibody[DL-101]

Sign In for Pricing
View Details
γ-Aminobutyric Acid-d6
TRC-A602922-25MG 25 mg

γ-Aminobutyric Acid-d6

Sign In for Pricing
View Details