Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein I2 (I2L)

This Recombinant Vaccinia virus Protein I2 (I2L) spans the amino acid sequence from region 1-73.

Product Specifications

Product Name Alternative

Protein I2

UniProt

P68604

Expression Region

1-73

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly-L-arginine Coated - 96 well Solid plates - White PS
MCW13F-AR 10x 96 Well Plates

Poly-L-arginine Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
PAK1 (NM_001128620) Human Over-expression Lysate
LY426982 100 µg

PAK1 (NM_001128620) Human Over-expression Lysate

Sign In for Pricing
View Details
Crb3 Mouse Gene Knockout Kit (CRISPR)
KN503801 1 Kit

Crb3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FNBP3 (PRPF40A) activation kit by CRISPRa
GA110862 1 Kit

Human FNBP3 (PRPF40A) activation kit by CRISPRa

Sign In for Pricing
View Details
L-Aspartyl-L-phenylalanine Trifluoroacetic Acid Salt
TRC-A790008-50MG 50 mg

L-Aspartyl-L-phenylalanine Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF568 conjugate, 0.1mg/mL
BNC680990-500 1x 500 µL

Mucin 3 (M3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details