Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Structural protein VP1 (VP1)

This Recombinant Structural protein VP1 (VP1) spans the amino acid sequence from region 72-144.

Product Specifications

Product Name Alternative

Structural protein VP1

UniProt

P20223

Expression Region

72-144

Origin

Sulfolobus virus-like particle SSV1

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EATNIGVLLGLFIFILIGIVLLPVIVSQVNNLTSGTSPQVTGTNATLLNLVPLFYILVLI IVPAVVAYKIYKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag
055719-01 10 µg

Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag
055719-02 50 µg

Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag
055719-03 100 µg

Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag
055719-04 200 µg

Receptor Interacting Serine Threonine Kinase 1 (RIPK1), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Filcons (disposable cell strainer syringe fitting, 100 units) range between 10 and 500 um STERILE
050-47S1 100 Units/Case

Filcons (disposable cell strainer syringe fitting, 100 units) range between 10 and 500 um STERILE

Sign In for Pricing
View Details
HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (APC)
128060-APC 100 µL

HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (APC)

Sign In for Pricing
View Details