Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Structural protein VP1 (VP1)

This Recombinant Structural protein VP1 (VP1) spans the amino acid sequence from region 72-144.

Product Specifications

Product Name Alternative

Structural protein VP1

UniProt

P20223

Expression Region

72-144

Origin

Sulfolobus virus-like particle SSV1

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EATNIGVLLGLFIFILIGIVLLPVIVSQVNNLTSGTSPQVTGTNATLLNLVPLFYILVLI IVPAVVAYKIYKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylhydrocupreine hydrochloride
T40417-01 25 mg

Ethylhydrocupreine hydrochloride

Sign In for Pricing
View Details
Ethylhydrocupreine hydrochloride
T40417-02 1 mL - 10 mM (in DMSO)

Ethylhydrocupreine hydrochloride

Sign In for Pricing
View Details
Ethylhydrocupreine hydrochloride
T40417-03 50 mg

Ethylhydrocupreine hydrochloride

Sign In for Pricing
View Details
Ethylhydrocupreine hydrochloride
T40417-04 100 mg

Ethylhydrocupreine hydrochloride

Sign In for Pricing
View Details
Ethylhydrocupreine hydrochloride
T40417-05 200 mg

Ethylhydrocupreine hydrochloride

Sign In for Pricing
View Details
Lentiviral human PRPSAP2 shRNA (UAS) - Lentiviral human PRPSAP2 shRNA (UAS) (100)
GTR15316113 1 Vial

Lentiviral human PRPSAP2 shRNA (UAS) - Lentiviral human PRPSAP2 shRNA (UAS) (100)

Sign In for Pricing
View Details