Recombinant Rickettsia africae ATP synthase subunit c (atpE)
This Recombinant Rickettsia africae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-74.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
C3PM50
Expression Region
1-74
Origin
Rickettsia africae (strain ESF-5)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDMVSLKFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLTEAM GLFSFVIAMLLIFS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681991-100 1x 100 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042602-500 1x 500 µL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941553-500 1x 500 µL
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details