Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia bellii ATP synthase subunit c (atpE)

This Recombinant Rickettsia bellii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1RGZ2

Expression Region

1-74

Origin

Rickettsia bellii (strain RML369-C)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMVSLKFIGVGCMAIGMLGAALGVSNIFSSLLNSIARNPSATEQLQRMALIGAGLAEAM GLFSFVIAMLLIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1030), CF594 conjugate, 0.1mg/mL
BNC941030-100 1x 100 µL

CD66 (CEA) (C66/1030), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL
BNC882350-100 1x 100 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372), CF594 conjugate, 0.1mg/mL
BNC940372-500 1x 500 µL

CD6 (C6/372), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details