Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1386 (MJ1386)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1386 (MJ1386) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1386

UniProt

Q58781

Expression Region

1-74

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIYDAVVKTTFQISTSIFFDYIYFFDYKGMKMAEIFAVNNYTELKKIRRMITFGFTVLG LGIGMIFGDAGLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For POU domain, class 3, transcription factor 3
E1616p 96 Tests

ELISA Kit For POU domain, class 3, transcription factor 3

Sign In for Pricing
View Details
Golga1 (NM_029793) Mouse Tagged ORF Clone
MG210502 10 µg

Golga1 (NM_029793) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Noxo1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3495903 1.0 µg DNA

Noxo1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
VAC14 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-12679R-BF405 100 µL

VAC14 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Rabbit CD79A Recombinant Monoclonal Antibody
orb1519405-01 10 µL

Rabbit CD79A Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit CD79A Recombinant Monoclonal Antibody
orb1519405-02 100 µL

Rabbit CD79A Recombinant Monoclonal Antibody

Sign In for Pricing
View Details