Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0290657 (DDB_G0290657)

This Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0290657 (DDB_G0290657) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

Putative uncharacterized transmembrane protein DDB_G0290657

UniProt

Q54FX7

Expression Region

1-74

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGPRYAHSNYGGNKGGPSNSTSGVFAGDIRCQVSNKSIMLISLKITNSPNSNSRGSSSS SSTSKSSSKTSFTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-500 1x 500 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-100 1x 100 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details