Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter pomeroyi ATP synthase subunit c (atpE)

This Recombinant Silicibacter pomeroyi ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5LNH0

Expression Region

1-74

Origin

Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDLAHIGAGLAAIGSGAAAIGVGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALG IFAFLVALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK beta (IKBKB) (NM_001556) Human Recombinant Protein
TP319154L 1 mg

IKK beta (IKBKB) (NM_001556) Human Recombinant Protein

Sign In for Pricing
View Details
FAM83A (NM_207006) Human Over-expression Lysate
LC404130 20 µg

FAM83A (NM_207006) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Troponin I Antibody
RC-15851-01 50 μL

Recombinant Troponin I Antibody

Sign In for Pricing
View Details
Recombinant Troponin I Antibody
RC-15851-02 100 µL

Recombinant Troponin I Antibody

Sign In for Pricing
View Details
Recombinant Troponin I Antibody
RC-15851-03 1 mL

Recombinant Troponin I Antibody

Sign In for Pricing
View Details
(-)-Limonene
TRC-L461745-5G 5 g

(-)-Limonene

Sign In for Pricing
View Details