Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter pomeroyi ATP synthase subunit c (atpE)

This Recombinant Silicibacter pomeroyi ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5LNH0

Expression Region

1-74

Origin

Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDLAHIGAGLAAIGSGAAAIGVGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALG IFAFLVALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hnRNP Q (SYNCRIP) (NM_001159675) Human Over-expression Lysate
LY431504 100 µg

hnRNP Q (SYNCRIP) (NM_001159675) Human Over-expression Lysate

Sign In for Pricing
View Details
Tbxas1 Mouse Gene Knockout Kit (CRISPR)
KN517297 1 Kit

Tbxas1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RCBTB1 Antibody
8C0314-AAT 50 µg

RCBTB1 Antibody

Sign In for Pricing
View Details
Amplite® Fluorimetric D-Lactate Assay Kit
13810-AAT 200 Tests

Amplite® Fluorimetric D-Lactate Assay Kit

Sign In for Pricing
View Details
Human IL36 alpha (IL36A) activation kit by CRISPRa
GA109054 1 Kit

Human IL36 alpha (IL36A) activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Rabbit Polyclonal Antibody
AP06531PU-N 100 µg

Cytokeratin 8 (KRT8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details