Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit L (ndhL)
This Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit L (ndhL) spans the amino acid sequence from region 1-74.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit L, EC= 1.6.5.-, NAD (P) H dehydrogenase I subunit L, NDH-1 subunit L, NDH-L
UniProt
Q5N326
Expression Region
1-74
Origin
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTVTLIIAALYLALAGAYLLVVPAALYLYLQKRWYVASSWERAFMYFLVFFFFPGLLLLA PLLNFRPRSRQIPA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402075-500 1x 500 µL
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details