Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi ATP synthase subunit c (atpE)

This Recombinant Rickettsia typhi ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q68XQ0

Expression Region

1-74

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIVSLKFIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAM GLFAFVIAMLLIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF740 conjugate, 0.1mg/mL
BNC741999-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOCK8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D9]
TA801833BM 100 µL

DOCK8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D9]

Sign In for Pricing
View Details
Dansyl Chloride-d6
TRC-D177502-250MG 250 mg

Dansyl Chloride-d6

Sign In for Pricing
View Details
1,4-Diaminobutane
TRC-D416025-25G 25 g

1,4-Diaminobutane

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF640R conjugate, 0.1mg/mL
BNC401946-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calmodulin Recombinant Rabbit Monoclonal Antibody [SJ16-09]
ET1606-46 100 µL

Calmodulin Recombinant Rabbit Monoclonal Antibody [SJ16-09]

Sign In for Pricing
View Details