Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi ATP synthase subunit c (atpE)

This Recombinant Rickettsia typhi ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q68XQ0

Expression Region

1-74

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIVSLKFIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAM GLFAFVIAMLLIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD69 Antibody
KC-32280-01 50 μL

CD69 Antibody

Sign In for Pricing
View Details
CD69 Antibody
KC-32280-02 100 µL

CD69 Antibody

Sign In for Pricing
View Details
CD69 Antibody
KC-32280-03 1 mL

CD69 Antibody

Sign In for Pricing
View Details
Tenocyclidine Hydrochloride
TRC-T018450-5MG 5 mg

Tenocyclidine Hydrochloride

Sign In for Pricing
View Details
Cdk4 Mouse Monoclonal Antibody [5-C3-G3]
M1505-5 100 µL

Cdk4 Mouse Monoclonal Antibody [5-C3-G3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS631974 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details