Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit G (mtrG)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit G (mtrG) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit G, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit G

UniProt

Q6LWY8

Expression Region

1-74

Origin

Methanococcus maripaludis (strain S2 / LL)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIPTVVTPTKDYKRLQAKLDEIENTVENTNAEIIQRTGKKAGRDVGIAYGLAIGFIFV YVLGTVLPLFDLIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Interleukin 21 (IL21) ELISA Kit
RDR-IL21-Ra-96Tests 96 Tests

Rat Interleukin 21 (IL21) ELISA Kit

Sign In for Pricing
View Details
Rat Caspase 1 (CASP1) ELISA Kit
DL-CASP1-Ra-01 48 Tests

Rat Caspase 1 (CASP1) ELISA Kit

Sign In for Pricing
View Details
Rat Caspase 1 (CASP1) ELISA Kit
DL-CASP1-Ra-02 96 Tests

Rat Caspase 1 (CASP1) ELISA Kit

Sign In for Pricing
View Details
Rat Proteolipid Protein 1, Myelin (PLP1) ELISA Kit
RD-PLP1-Ra-96Tests 96 Tests

Rat Proteolipid Protein 1, Myelin (PLP1) ELISA Kit

Sign In for Pricing
View Details
ART2P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV757557 1.0 µg DNA

ART2P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Canine Zonulin ELISA Kit
EIA06575Ca 1 Kit

Canine Zonulin ELISA Kit

Sign In for Pricing
View Details