Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saimiri sciureus Cytochrome c oxidase subunit 6C (COX6C)

This Recombinant Saimiri sciureus Cytochrome c oxidase subunit 6C (COX6C) spans the amino acid sequence from region 2-75.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 6C, Cytochrome c oxidase polypeptide VIc

UniProt

Q7YRJ9

Expression Region

2-75

Origin

Saimiri sciureus (Common squirrel monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASEVLAKPQMRGLLARRLRIHMVGAFLISLGVAALYKFGVAEPRKKAYADFYKNYSPEKD FEEMKKAGVFRSIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
BNC741429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF647 conjugate, 0.1mg/mL
BNC471025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/492), CF405S conjugate, 0.1mg/mL
BNC040492-500 1x 500 µL

Moesin (MSN/492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details