Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Cytochrome c oxidase subunit 6C (COX6C)

This Recombinant Pongo pygmaeus Cytochrome c oxidase subunit 6C (COX6C) spans the amino acid sequence from region 2-75.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 6C, Cytochrome c oxidase polypeptide VIc

UniProt

Q7YRK3

Expression Region

2-75

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADRRKKAYADFYRNYDVMKD FEEMRKAGIFQSVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-500 1x 500 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF568 conjugate, 0.1mg/mL
BNC682871-500 1x 500 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF740 conjugate, 0.1mg/mL
BNC740988-100 1x 100 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF647 conjugate, 0.1mg/mL
BNC471853-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details