Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C27F1.10 (SPAC27F1.10)

This Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C27F1.10 (SPAC27F1.10) spans the amino acid sequence from region 28-101.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C27F1.10

UniProt

Q9C112

Expression Region

28-101

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FIPYKSQTGKAPKCLVPYWLSIRLSLLYFKLTEAISFTEKCEKYNISLFDSTFVFGYIVN CFFIIHLNTFLTSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details