Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max ATP synthase subunit 9, mitochondrial (ATP9)

This Recombinant Glycine max ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit 9, mitochondrial, Lipid-binding protein

UniProt

P69421

Expression Region

1-74

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEGAKSIGAGAATIASAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIA LFALMMAFLILFVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-100 1x 100 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF594 conjugate, 0.1mg/mL
BNC942250-100 1x 100 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF568 conjugate, 0.1mg/mL
BNC681976-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details