Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha ATP synthase subunit 9, mitochondrial (ATP9)

This Recombinant Marchantia polymorpha ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit 9, mitochondrial, Lipid-binding protein

UniProt

P26855

Expression Region

1-74

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEGAKLIGAGAATIALAGAAVGIGNVFSSLINSVARNPSLAKQLFGYAILGFALTEAIA LFALMMAFLILFVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sox8 Mouse shRNA Plasmid (Locus ID 20681)
TR502114 1 Kit

Sox8 Mouse shRNA Plasmid (Locus ID 20681)

Sign In for Pricing
View Details
Mouse ATP-sensitive inward rectifier potassium channel 10,KCNJ10 ELISA KIT
JOT-EK1315Mo-01 96 Well

Mouse ATP-sensitive inward rectifier potassium channel 10,KCNJ10 ELISA KIT

Sign In for Pricing
View Details
Mouse ATP-sensitive inward rectifier potassium channel 10,KCNJ10 ELISA KIT
JOT-EK1315Mo-02 48 Well

Mouse ATP-sensitive inward rectifier potassium channel 10,KCNJ10 ELISA KIT

Sign In for Pricing
View Details
KIAA1683 Protein Lysate (Human) with C-Ha Tag
25634032 100 µg

KIAA1683 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
IRDye 800 200 nmol scale
26-6673-02 1 Each

IRDye 800 200 nmol scale

Sign In for Pricing
View Details
APOER2 Rabbit pAb
MBS8543477-01 0.1 mL

APOER2 Rabbit pAb

Sign In for Pricing
View Details