Recombinant Bifidobacterium longum ATP synthase subunit c (atpE)
This Recombinant Bifidobacterium longum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-75.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
B3DTV5
Expression Region
1-75
Origin
Bifidobacterium longum (strain DJO10A)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDIITLAEVAGNLSVIGYGIGTLGPGIGLGILFGKAMESTARQPEMSGKIQTIMFIGLAL VEVLALIGFVAALII
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Recombinant Streptococcus equi subsp. equi GMP synthase [glutamine-hydrolyzing] (guaA), partial](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
MBS1215121 Inquire
Recombinant Streptococcus equi subsp. equi GMP synthase [glutamine-hydrolyzing] (guaA), partial
Sign In for Pricing
View Details 
MBS626916-01 0.04 mg
Protein Kinase C, iota, lambda (PKCi, PKC, Atypical Protein Kinase C lambda/iota, aPKC lambda iota, PRKCL, DXS1179E, MGC26534)
Sign In for Pricing
View Details MBS626916-02 5x 0.04 mg
Protein Kinase C, iota, lambda (PKCi, PKC, Atypical Protein Kinase C lambda/iota, aPKC lambda iota, PRKCL, DXS1179E, MGC26534)
Sign In for Pricing
View Details