Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium longum ATP synthase subunit c (atpE)

This Recombinant Bifidobacterium longum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3DTV5

Expression Region

1-75

Origin

Bifidobacterium longum (strain DJO10A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIITLAEVAGNLSVIGYGIGTLGPGIGLGILFGKAMESTARQPEMSGKIQTIMFIGLAL VEVLALIGFVAALII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morphine (MaxLight 750) discontinued
215036-ML750 100 µL

Morphine (MaxLight 750) discontinued

Sign In for Pricing
View Details
RPL27 Antibody, HRP conjugated
A36507-100UG 100 µg

RPL27 Antibody, HRP conjugated

Sign In for Pricing
View Details
Tris Base
T838-25KG 25 Kg

Tris Base

Sign In for Pricing
View Details
Adh6 Rat Pre-designed siRNA Set A
HY-RS23987 1 Set

Adh6 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
BI 6015
TRC-B373480-100MG 100 mg

BI 6015

Sign In for Pricing
View Details
pCMV-GST-BRAT1-Neo Plasmid
PVT47482 2 µg

pCMV-GST-BRAT1-Neo Plasmid

Sign In for Pricing
View Details