Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yezF (yezF)

This Recombinant Uncharacterized membrane protein yezF (yezF) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yezF

UniProt

C0H3X3

Expression Region

1-75

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPNISLINAVFRIACGLTIMSAASAKFTKKPWCRMHLFYIFMGAMKAGSGILRFCPVTY MFQHSDSGNNEHQNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fbln2 activation kit by CRISPRa
GA201365 1 Kit

Mouse Fbln2 activation kit by CRISPRa

Sign In for Pricing
View Details
IKB beta (NFKBIB) (NM_002503) Human Over-expression Lysate
LY419285 100 µg

IKB beta (NFKBIB) (NM_002503) Human Over-expression Lysate

Sign In for Pricing
View Details
MCM2 Rabbit Polyclonal Antibody
TA368848 100 µL

MCM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD117 (KIT/982), CF488A conjugate, 0.1mg/mL
BNC880982-500 1x 500 µL

CD117 (KIT/982), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCBD2 (NM_032151) Human Recombinant Protein
TP308859M 100 µg

PCBD2 (NM_032151) Human Recombinant Protein

Sign In for Pricing
View Details
CD300LB Antibody
KC-28080-01 50 μL

CD300LB Antibody

Sign In for Pricing
View Details