Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yezF (yezF)

This Recombinant Uncharacterized membrane protein yezF (yezF) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yezF

UniProt

C0H3X3

Expression Region

1-75

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPNISLINAVFRIACGLTIMSAASAKFTKKPWCRMHLFYIFMGAMKAGSGILRFCPVTY MFQHSDSGNNEHQNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Formylamino)-3-hydroxy-2-propenoic Acid Ethyl Ester
TRC-F695690-10MG 10 mg

2-(Formylamino)-3-hydroxy-2-propenoic Acid Ethyl Ester

Sign In for Pricing
View Details
1-(Benzyloxy)propan-2-one
TRC-B289158-50MG 50 mg

1-(Benzyloxy)propan-2-one

Sign In for Pricing
View Details
Rims4 Mouse Gene Knockout Kit (CRISPR)
KN514830 1 Kit

Rims4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-PDGFR beta (Y1021) Recombinant Rabbit Monoclonal Antibody [JE48-54]
HA721833 100 µL

Phospho-PDGFR beta (Y1021) Recombinant Rabbit Monoclonal Antibody [JE48-54]

Sign In for Pricing
View Details
SIGLEC9 Rabbit Polyclonal Antibody
TA364716 100 µL

SIGLEC9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Eidd 1931
TRC-E985800-500MG 500 mg

Eidd 1931

Sign In for Pricing
View Details