Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yezF (yezF)

This Recombinant Uncharacterized membrane protein yezF (yezF) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yezF

UniProt

C0H3X3

Expression Region

1-75

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPNISLINAVFRIACGLTIMSAASAKFTKKPWCRMHLFYIFMGAMKAGSGILRFCPVTY MFQHSDSGNNEHQNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casp2 Mouse Gene Knockout Kit (CRISPR)
KN502565 1 Kit

Casp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Oleamide
TRC-O255000-1G 1 g

Oleamide

Sign In for Pricing
View Details
LY6D (NM_003695) Human Over-expression Lysate
LC401220 20 µg

LY6D (NM_003695) Human Over-expression Lysate

Sign In for Pricing
View Details
(-)-b-Bisabolene (>85%)
TRC-B399805-50MG 50 mg

(-)-b-Bisabolene (>85%)

Sign In for Pricing
View Details
Human ER81 (ETV1) activation kit by CRISPRa
GA101472 1 Kit

Human ER81 (ETV1) activation kit by CRISPRa

Sign In for Pricing
View Details
2-(1-Piperidino)aniline
TRC-P481935-100MG 100 mg

2-(1-Piperidino)aniline

Sign In for Pricing
View Details