Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus phage r1t Holin

This Recombinant Lactococcus phage r1t Holin spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Holin

UniProt

Q38134

Expression Region

1-75

Origin

Lactococcus phage r1t (Bacteriophage r1t)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTFFKDMAERAIKTFAQAMIGALGAGATGLIGVDWLQALSIAGFATVVSILTSLASGIP GDNTASLVNNKKEGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMEL Recombinant Rabbit mAb, PE conjugated
orb2330875 100 µL

PMEL Recombinant Rabbit mAb, PE conjugated

Sign In for Pricing
View Details
SERPINB3 Antibody
DF7335-01 100 µL

SERPINB3 Antibody

Sign In for Pricing
View Details
SERPINB3 Antibody
DF7335-02 200 µL

SERPINB3 Antibody

Sign In for Pricing
View Details
ATP5B (ATP Synthase Subunit Beta, Mitochondrial, ATPMB, ATPSB, HEL-S-271) (MaxLight 490)
MBS6407725-01 0.1 mL

ATP5B (ATP Synthase Subunit Beta, Mitochondrial, ATPMB, ATPSB, HEL-S-271) (MaxLight 490)

Sign In for Pricing
View Details
ATP5B (ATP Synthase Subunit Beta, Mitochondrial, ATPMB, ATPSB, HEL-S-271) (MaxLight 490)
MBS6407725-02 5x 0.1 mL

ATP5B (ATP Synthase Subunit Beta, Mitochondrial, ATPMB, ATPSB, HEL-S-271) (MaxLight 490)

Sign In for Pricing
View Details
Goat Antithrombin receptor ELISA Kit
MBS750801-01 48 Well

Goat Antithrombin receptor ELISA Kit

Sign In for Pricing
View Details