Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus phage r1t Holin

This Recombinant Lactococcus phage r1t Holin spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Holin

UniProt

Q38134

Expression Region

1-75

Origin

Lactococcus phage r1t (Bacteriophage r1t)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTFFKDMAERAIKTFAQAMIGALGAGATGLIGVDWLQALSIAGFATVVSILTSLASGIP GDNTASLVNNKKEGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMAA, NT (MMAA, Methylmalonic aciduria type A protein, mitochondrial) (MaxLight 405) discontinued
038490-ML405 100 µL

MMAA, NT (MMAA, Methylmalonic aciduria type A protein, mitochondrial) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ARHGAP42 (Phospho-Tyr376) Antibody
MBS9519178-01 0.05 mL

ARHGAP42 (Phospho-Tyr376) Antibody

Sign In for Pricing
View Details
ARHGAP42 (Phospho-Tyr376) Antibody
MBS9519178-02 0.1 mL

ARHGAP42 (Phospho-Tyr376) Antibody

Sign In for Pricing
View Details
ARHGAP42 (Phospho-Tyr376) Antibody
MBS9519178-03 0.2 mL

ARHGAP42 (Phospho-Tyr376) Antibody

Sign In for Pricing
View Details
ARHGAP42 (Phospho-Tyr376) Antibody
MBS9519178-04 5x 0.2 mL

ARHGAP42 (Phospho-Tyr376) Antibody

Sign In for Pricing
View Details
(D-Ala2) -Dynorphin A (1-9)
FA108730-01 2000 µg

(D-Ala2) -Dynorphin A (1-9)

Sign In for Pricing
View Details