Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus phage r1t Holin

This Recombinant Lactococcus phage r1t Holin spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Holin

UniProt

Q38134

Expression Region

1-75

Origin

Lactococcus phage r1t (Bacteriophage r1t)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTFFKDMAERAIKTFAQAMIGALGAGATGLIGVDWLQALSIAGFATVVSILTSLASGIP GDNTASLVNNKKEGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BeyoGoldTM Erlenmeyer Flasks with Vented Cap
FFLK250 12 PCS/Box

BeyoGoldTM Erlenmeyer Flasks with Vented Cap

Sign In for Pricing
View Details
DEPDC1, NT (DEPDC1, DEPDC1A, DEP domain-containing protein 1A) (MaxLight 405) discontinued
034588-ML405 100 µL

DEPDC1, NT (DEPDC1, DEPDC1A, DEP domain-containing protein 1A) (MaxLight 405) discontinued

Sign In for Pricing
View Details
GOSR2 siRNA (Human)
orb1861891-01 15 nmol

GOSR2 siRNA (Human)

Sign In for Pricing
View Details
GOSR2 siRNA (Human)
orb1861891-02 30 nmol

GOSR2 siRNA (Human)

Sign In for Pricing
View Details
GMFB Antibody
orb1255732 100 µL

GMFB Antibody

Sign In for Pricing
View Details
Human KICS2 qPCR Primer Pair
QH64097S 200 Tests

Human KICS2 qPCR Primer Pair

Sign In for Pricing
View Details