Recombinant Wolbachia sp. subsp. Brugia malayi ATP synthase subunit c (atpE)
This Recombinant Wolbachia sp. subsp. Brugia malayi ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-75.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q5GSH7
Expression Region
1-75
Origin
Wolbachia sp. subsp. Brugia malayi (strain TRS)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDLVALKFIAIGLSVLGILGAGLGVANIFSTMLSGLARNPESEGKMKIYVYVGAGMVEFT GLLAFVLAMLLMFVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042848-100 1x 100 µL
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400460-100 1x 100 µL
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 