Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF36 (ORF36)

This Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF36 (ORF36) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF36

UniProt

Q6R7I8

Expression Region

1-75

Origin

Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTEQTVCEIEQESELIPAKPQYIIVKKPKRQAWQRVLLLFRIINMIVIWAALIALFVK LYILRGPIPRSYFHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-500 1x 500 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF568 conjugate, 0.1mg/mL
BNC682556-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), CF640R conjugate, 0.1mg/mL
BNC401931-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/1931), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details