Recombinant ATP synthase subunit c (atpE)
This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-75.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q73HW2
Expression Region
1-75
Origin
Wolbachia pipientis wMel
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDLVALKFIAIGLAVFGMLGAGLGIANIFSAMLNGIARNPESEGKMKSYVYIGAAMVEIM GLLAFVLAMLLIFAA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PC32206 1 Each
4- (3-oxo-3-phenylprop-1-enyl) phenyl 4-fluorobenzene-1-sulphonate
Sign In for Pricing
View Details NBP2-34810G 0.1 mL
Mouse Monoclonal Von Willebrand Factor Antibody (SPM577) [DyLight 488]
Sign In for Pricing
View Details 