Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial

This Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial spans the amino acid sequence from region 57-131.

Product Specifications

Product Name Alternative

ATP synthase lipid-binding protein, mitochondrial, ATPase protein 9, ATPase subunit c

UniProt

Q9U505

Expression Region

57-131

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMMAFLLLFAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TTC39B activation kit by CRISPRa
GA115950 1 Kit

Human TTC39B activation kit by CRISPRa

Sign In for Pricing
View Details
CD99 Rabbit Polyclonal Antibody
TA369929 100 µL

CD99 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D-Lysine hydrochloride
TRC-L468918-500MG 500 mg

D-Lysine hydrochloride

Sign In for Pricing
View Details
(1’S,2S)-2-[(1’,2’-O-Isopropylidene)dihydroxyethyl]-6-fluorochroman-4-one
TRC-I824950-250MG 250 mg

(1’S,2S)-2-[(1’,2’-O-Isopropylidene)dihydroxyethyl]-6-fluorochroman-4-one

Sign In for Pricing
View Details
Rprd1b Mouse Gene Knockout Kit (CRISPR)
KN515073 1 Kit

Rprd1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125M-01 50 Tests

Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details