Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial

This Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial spans the amino acid sequence from region 57-131.

Product Specifications

Product Name Alternative

ATP synthase lipid-binding protein, mitochondrial, ATPase protein 9, ATPase subunit c

UniProt

Q9U505

Expression Region

57-131

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMMAFLLLFAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lambda Light Chain (LAM03), CF405S conjugate, 0.1mg/mL
BNC040636-100 1x 100 µL

Human Lambda Light Chain (LAM03), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR2J3 Human Gene Knockout Kit (CRISPR)
KN415580 1 Kit

OR2J3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Urine Total RNA Purification Maxi 96-Well Kit (Slurry Format)
29650 96 Preparations

Urine Total RNA Purification Maxi 96-Well Kit (Slurry Format)

Sign In for Pricing
View Details
Sodium 2-Hydroxybutyrate
TRC-S509425-5G 5 g

Sodium 2-Hydroxybutyrate

Sign In for Pricing
View Details
Recombinant Rat IL-21 Protein (Sumo Tag)
PDER100126-01 20 µg

Recombinant Rat IL-21 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat IL-21 Protein (Sumo Tag)
PDER100126-02 100 µg

Recombinant Rat IL-21 Protein (Sumo Tag)

Sign In for Pricing
View Details