Recombinant Pseudoalteromonas phage PM2 Protein P8 (VIII)
This Recombinant Pseudoalteromonas phage PM2 Protein P8 (VIII) spans the amino acid sequence from region 1-75.
Product Specifications
Product Name Alternative
Protein P8, Protein VIII
UniProt
Q9XJR5
Expression Region
1-75
Origin
Pseudoalteromonas phage PM2 (Bacteriophage PM2)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLGALMGVAGGAPMGGASPMGGMPSIASSSSAETGQQTQSGNFTGGGINFGSNNNNQLLI VGAVVIGLFLVIKRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY419953 100 µg
EIF2G (EIF2S3) (NM_001415) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC741063-500 1x 500 µL
VEGF-A (VEGF/1063), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 