Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudoalteromonas phage PM2 Protein P8 (VIII)

This Recombinant Pseudoalteromonas phage PM2 Protein P8 (VIII) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Protein P8, Protein VIII

UniProt

Q9XJR5

Expression Region

1-75

Origin

Pseudoalteromonas phage PM2 (Bacteriophage PM2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGALMGVAGGAPMGGASPMGGMPSIASSSSAETGQQTQSGNFTGGGINFGSNNNNQLLI VGAVVIGLFLVIKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Her2 (ERBB2) Mouse Monoclonal Antibody [Clone ID: HRB2/451]
AM32822PU-T 20 µg

Her2 (ERBB2) Mouse Monoclonal Antibody [Clone ID: HRB2/451]

Sign In for Pricing
View Details
PLAA Rabbit Monoclonal Antibody [Clone ID: 23GB2560]
TA425090 100 µL

PLAA Rabbit Monoclonal Antibody [Clone ID: 23GB2560]

Sign In for Pricing
View Details
LTBR (NM_002342) Human Over-expression Lysate
LC400841 20 µg

LTBR (NM_002342) Human Over-expression Lysate

Sign In for Pricing
View Details
ANKRD40 (NM_052855) Human Recombinant Protein
TP303512 20 µg

ANKRD40 (NM_052855) Human Recombinant Protein

Sign In for Pricing
View Details
TAS2R1 Rabbit Polyclonal Antibody
AP01340PU-N 100 µg

TAS2R1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P4hb Mouse Monoclonal Antibody [Clone ID: 6-9H6]
TA363861 100 µg

P4hb Mouse Monoclonal Antibody [Clone ID: 6-9H6]

Sign In for Pricing
View Details